PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0024s0676.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family GATA
Protein Properties Length: 382aa    MW: 42462.8 Da    PI: 5.4136
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0024s0676.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA41.91.4e-13201234135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          C++C+tt+ p+WR+ p+g + +C  CGl+ rk+g+
  Kaladp0024s0676.2.p 201 CAHCNTTQAPMWRKTPSGAR-ICDFCGLRLRKRGM 234
                          ********************.***********996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004014.9E-10195244IPR000679Zinc finger, GATA-type
PROSITE profilePS5011415.512195248IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.0E-13196245IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577164.75E-11197249No hitNo description
CDDcd002021.03E-9200243No hitNo description
PfamPF003203.6E-10201233IPR000679Zinc finger, GATA-type
PROSITE profilePS5152514.379300381IPR027353NET domain
PfamPF170354.5E-15310371IPR027353NET domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MSVSPSSDGP KKEVPDYIGF FTHELEDLMS GADVAGDDFF PLLGFKSDAA GRQMRGDDAN  60
ESREGGGGLK KSGSLFCDGL GGELSNYKKE KLKGLLKQSV SIFTQEVDQM VEVVLATCQL  120
QHRLRSKGTA SSSQDSASGN NERARSSEKM KRGKFTSPKT SDAPAPVRPP ANIESVEEGY  180
LERPRKFRSM IDILSQNGQS CAHCNTTQAP MWRKTPSGAR ICDFCGLRLR KRGMQLSPQK  240
KDQTITGSVQ EADNKDEEVT DDLKFLLGND RLQVEQTMKK YADEISASLG LLEQQLEGFL  300
DNVTSKCRSM TFFEKQSLWS LIKDLPPENF DRVVEIIKRS RGLDQRDEND ILVDLEDTDN  360
AVLWRLYYYA KAVENARNLV G*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G45170.12e-07GATA transcription factor 14